제품 > 항체 > 다중클론항체(pAb)

SAT2 Rabbit pAb (A7211)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

Western blot analysis of extracts of various cell lines, using (A7211) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

ABclonal:Immunofluorescence - SAT2 Rabbit pAb (A7211)

Immunofluorescence analysis of A-549 cells using SAT2 antibody (A7211). Blue: DAPI for nuclear staining.

Overview

Product name	SAT2 Rabbit pAb
Catalog No.	A7211
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables diamine N-acetyltransferase activity and identical protein binding activity. Involved in polyamine metabolic process. Located in extracellular exosome.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human SAT2 (NP_597998.1).
Sequence	MASVRIREAKEGDCGDILRLIRELAEFEKLSDQVKISEEALRADGFGDNPFYHCLVAEILPAPGKLLGPCVVGYGIYYFIYSTWKGRTIYLEDIYVMPEYRGQGIGSKIIKKVAEVALDKGCSQFRLAVLDWNQRAMDLYKALGAQDLTEAEGWHFFCFQGEATRKLAGK
Gene ID
Swiss Prot
Synonyms	SSAT2; SSAT-2
Calculated MW	19kDa
Observed MW	19kDa

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:100 - 1:500 IF/ICC 1:50 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa, 293T, Rat kidney
Cellular location	Cytoplasm