제품 > 항체 > 단일클론항체(mAb)

SATB2 Rabbit mAb (A19837)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from Rat brain, using SATB2 Rabbit mAb (A19837) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - SATB2 Rabbit mAb (A19837)

Immunohistochemistry analysis of paraffin-embedded Human appendix using SATB2 Rabbit mAb (A19837) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using SATB2 Rabbit mAb (A19837) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human colon using SATB2 Rabbit mAb (A19837) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunoprecipitation - SATB2 Rabbit mAb (A19837)

Immunoprecipitation analysis of 300 μg extracts of K-562 cells using 3 μg SATB2 antibody (A19837). Western blot was performed from the immunoprecipitate using SATB2 antibody (A19837) at a dilution of 1:1000.

Overview

Product name	SATB2 Rabbit mAb
Catalog No.	A19837
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2363

Background

This gene encodes a DNA binding protein that specifically binds nuclear matrix attachment regions. The encoded protein is involved in transcription regulation and chromatin remodeling. Defects in this gene are associated with isolated cleft palate and cognitive disability. Alternate splicing results in multiple transcript variants that encode the same protein.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200-300 of human SATB2 (Q9UPW6).
Sequence	SMISSIVNSTYYANVSATKCQEFGRWYKKYKKIKVERVERENLSDYCVLGQRPMHLPNMNQLASLGKTNEQSPHSQIHHSTPIRNQVPALQPIMSPGLLSP
Gene ID
Swiss Prot
Synonyms	GLSS; DEL2Q32Q33; C2DELq32q33; SATB2
Calculated MW	83kDa
Observed MW	100kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:100 - 1:500 IHC-P 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	Rat brain
Cellular location