제품 > 항체 > 다중클론항체(pAb)

SATB2 Rabbit pAb (A16721)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

Western blot analysis of lysates from LO2 cells, using SATB2 Rabbit pAb (A16721) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - SATB2 Rabbit pAb (A16721)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using SATB2 Rabbit pAb (A16721) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Overview

Product name	SATB2 Rabbit pAb
Catalog No.	A16721
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a DNA binding protein that specifically binds nuclear matrix attachment regions. The encoded protein is involved in transcription regulation and chromatin remodeling. Defects in this gene are associated with isolated cleft palate and cognitive disability. Alternate splicing results in multiple transcript variants that encode the same protein.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 634-733 of human SATB2 (NP_001165980.1).
Sequence	HDVGLYPDQEAIHTLSAQLDLPKHTIIKFFQNQRYHVKHHGKLKEHLGSAVDVAEYKDEELLTESEENDSEEGSEEMYKVEAEEENADKSKAAPAEIDQR
Gene ID
Swiss Prot
Synonyms	GLSS; DEL2Q32Q33; C2DELq32q33; SATB2
Calculated MW	83kDa
Observed MW	83kDa

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	LO2
Cellular location	histone deacetylase complex, nuclear matrix, nucleoplasm