Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates, using SDHC Rabbit mAb (A22280) at1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of SDHC in paraffin-embedded rat kidney tissue using SDHC Rabbit mAb (A22280) at a dilution of 1:600 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of SDHC in paraffin-embedded human kidney tissue using SDHC Rabbit mAb (A22280) at a dilution of 1:600 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of SDHC in paraffin-embedded human liver cancer tissue using SDHC Rabbit mAb (A22280) at a dilution of 1:600 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of SDHC in paraffin-embedded human liver tissue using SDHC Rabbit mAb (A22280) at a dilution of 1:600 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of SDHC in paraffin-embedded mouse liver tissue using SDHC Rabbit mAb (A22280) at a dilution of 1:600 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunofluorescence analysis of A431 cells using SDHC Rabbit mAb (A22280) at dilution of 1:100(40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of HeLa cells using SDHC Rabbit mAb (A22280) at dilution of 1:100(40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Product name | SDHC Rabbit mAb |
|---|---|
| Catalog No. | A22280 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC55260 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SDHC (NP_002992.1). |
|---|---|
| Sequence | MAALLLRHVGRHCLRAHFSPQLCIRNAVPLGTTAKEEMERFWNKNIGSNRPLSPHITIYSWSLPMAMSICHRGTGIALSAGVSLFGMSALLLPGNFESYL |
| Gene ID | |
| Swiss Prot | |
| Synonyms | CYBL; PGL3; QPS1; SDH3; CYB560; SDHC |
| Calculated MW | 19kDa |
| Observed MW | 12kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | 293F, HeLa, Mouse kidney, Rat liver, Rat heart |
| Cellular location | Mitochondrion inner membrane, Multi-pass membrane protein |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
