Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | SELENOM Rabbit pAb |
---|---|
Catalog No. | A16660 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 50-130 of human SELENOM (NP_536355.1). |
---|---|
Sequence | LNRLKEVKAFVTQDIPFYHNLVMKHLPGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAPDAQVPPEYVW |
Gene ID | |
Swiss Prot | |
Synonyms | SELM; SEPM; SELENOM |
Calculated MW | 16kDa |
Observed MW | 16kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Raji, A-431, Mouse kidney, Mouse heart, Mouse brain |
Cellular location | endoplasmic reticulum lumen, Golgi apparatus, perinuclear region of cytoplasm |
Customer validation | WB(Gallus gallus, Sus scrofa) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A16660? Please let us know so that we can cite the reference in this datasheet.