제품 > 항체 > 다중클론항체(pAb)

SERPINB9 Rabbit pAb (A6393)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using SERPINB9 antibody (A6393) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - SERPINB9 Rabbit pAb (A6393)

Immunofluorescence analysis of C6 cells using SERPINB9 antibody (A6393) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of HeLa cells using SERPINB9 antibody (A6393) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of L929 cells using SERPINB9 antibody (A6393) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	SERPINB9 Rabbit pAb
Catalog No.	A6393
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a member of the serine protease inhibitor family which are also known as serpins. The encoded protein belongs to a subfamily of intracellular serpins. This protein inhibits the activity of the effector molecule granzyme B. Overexpression of this protein may prevent cytotoxic T-lymphocytes from eliminating certain tumor cells. A pseudogene of this gene is found on chromosome 6.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 170-308 of human SERPINB9 (NP_004146.1).
Sequence	KWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADLSAMSAERD
Gene ID
Swiss Prot
Synonyms	PI9; CAP3; PI-9; CAP-3
Calculated MW	42kDa
Observed MW	42kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:10 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	SW480, SKOV3, Mouse lung, Mouse spleen, Rat spleen, Rat thymus
Cellular location	Cytoplasm
Customer validation	WB(Homo sapiens)