제품 > 항체 > 다중클론항체(pAb)

SETD1B Rabbit pAb (A24505)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Immunohistochemistry analysis of paraffin-embedded mouse lung using SETD1B Rabbit pAb (A24505) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Overview

Product name	SETD1B Rabbit pAb
Catalog No.	A24505
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

SET1B is a component of a histone methyltransferase complex that produces trimethylated histone H3 at Lys4 (Lee et al., 2007 [PubMed 17355966]).[supplied by OMIM, Mar 2008]

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 150-250 of human SETD1B (NP_001340274.1).
Sequence	VFATVRGAKDAVQHLHSTSVMGNIIHVELDTKGETRMRFYELLVTGRYTPQTLPVGELDAVSPIVNETLQLSDALKRLKDGGLSAGCGSGSSSVTPNSGGT
Gene ID
Swiss Prot
Synonyms	SETD1B; KMT2G; Set1B; SET domain containing 1B
Calculated MW	208kDa/212kDa
Observed MW	Refer to figures

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Immunohistochemistry
Positive samples
Cellular location	Chromosome, Nucleus speckle