제품 > 항체 > 단일클론항체(mAb)

SF3B3/SAP130 Rabbit mAb (A9624)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using SF3B3/SAP130 Rabbit mAb (A9624) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - SF3B3/SAP130 Rabbit mAb (A9624)

Immunohistochemistry analysis of SF3B3/SAP130 in paraffin-embedded Human lung adenocarcinoma tissue using SF3B3/SAP130 Rabbit mAb (A9624) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of SF3B3/SAP130 in paraffin-embedded human thyroid cancer tissue using SF3B3/SAP130 Rabbit mAb (A9624) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of SF3B3/SAP130 in paraffin-embedded mouse lung tissue using SF3B3/SAP130 Rabbit mAb (A9624) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of SF3B3/SAP130 in paraffin-embedded human colon carcinoma tissue using SF3B3/SAP130 Rabbit mAb (A9624) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of SF3B3/SAP130 in paraffin-embedded rat spleen tissue using SF3B3/SAP130 Rabbit mAb (A9624) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of SF3B3/SAP130 in paraffin-embedded rat colon tissue using SF3B3/SAP130 Rabbit mAb (A9624) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of SF3B3/SAP130 in paraffin-embedded mouse brain tissue using SF3B3/SAP130 Rabbit mAb (A9624) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of SF3B3/SAP130 in paraffin-embedded mouse spleen tissue using SF3B3/SAP130 Rabbit mAb (A9624) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of SF3B3/SAP130 in paraffin-embedded mouse testis tissue using SF3B3/SAP130 Rabbit mAb (A9624) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - SF3B3/SAP130 Rabbit mAb (A9624)

Immunofluorescence analysis of U-2 OS cells using SF3B3/SAP130 Rabbit mAb (A9624) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	SF3B3/SAP130 Rabbit mAb
Catalog No.	A9624
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1667

Background

This gene encodes subunit 3 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. Subunit 3 has also been identified as a component of the STAGA (SPT3-TAF(II)31-GCN5L acetylase) transcription coactivator-HAT (histone acetyltransferase) complex, and the TFTC (TATA-binding-protein-free TAF(II)-containing complex). These complexes may function in chromatin modification, transcription, splicing, and DNA repair.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1101-1217 of human SF3B3/SAP130 (Q15393).
Sequence	VLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRTPPEVSKKLEDIRTRYAF
Gene ID
Swiss Prot
Synonyms	RSE1; SAP130; SF3b130; STAF130; SF3B3/SAP130
Calculated MW	136kDa
Observed MW	130-136kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	Hep G2, Mouse testis, Rat lung
Cellular location	Nucleus