Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | SH3BP4 Rabbit pAb |
---|---|
Catalog No. | A14351 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 784-963 of human SH3BP4 (NP_055336.1). |
---|---|
Sequence | TFFCRAELDSEPERVASVLEKLKEDCNNTENKERKSFQKELVMALLKMDCQGLVVRLIQDFVLLTTAVEVAQRWRELAEKLAKVSKQQMDAYESPHRDRNGVVDSEAMWKPAYDFLLTWSHQIGDSYRDVIQELHLGLDKMKNPITKRWKHLTGTLILVNSLDVLRAAAFSPADQDDFVI |
Gene ID | |
Swiss Prot | |
Synonyms | TTP; BOG25; SH3BP4 |
Calculated MW | 107kDa |
Observed MW | 107kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HeLa, BxPC-3, HepG2, Mouse thymus, Mouse brain, Mouse heart, Mouse kidney |
Cellular location | Cytoplasmic vesicle, Membrane, Nucleus, clathrin-coated pit, clathrin-coated vesicle |
* For research use only. Not for therapeutic or diagnostic purposes.