Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | SHH Rabbit pAb |
---|---|
Catalog No. | A18863 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 187-281 of mouse SHH (NP_033196.1). |
---|---|
Sequence | KAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLRPGDRVLAADDQGRLLYSDFLTFLDRDEGAKKVFYVIETLEPRERLLLTAAHLLFVAPHNDS |
Gene ID | |
Swiss Prot | |
Synonyms | Hx; Dsh; Hhg1; Hxl3; ShhNC; M100081; 9530036O11Rik; SHH |
Calculated MW | 48kDa |
Observed MW | 45kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | A-549, Mouse lung, Mouse brain, Rat lung |
Cellular location | axon, dendrite, endoplasmic reticulum, extracellular region, extracellular space, Golgi apparatus, nucleus, plasma membrane, synaptic vesicle |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.