제품 > 항체 > 다중클론항체(pAb)

SIRT6 Rabbit pAb (A7416)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of extracts of various cell lines, using SIRT6 antibody (A7416) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Overview

Product name	SIRT6 Rabbit pAb
Catalog No.	A7416
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables several functions, including NAD(P)+-protein-arginine ADP-ribosyltransferase activity; NAD-dependent histone deacetylase activity (H3-K9 specific); and transcription corepressor activity. Involved in several processes, including cellular protein modification process; negative regulation of nucleobase-containing compound metabolic process; and positive regulation of cell population proliferation. Located in nucleus. Is expressed in several structures, including alimentary system; central nervous system; gonad; musculature; and retina. Used to study progeria. Orthologous to human SIRT6 (sirtuin 6).

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200-294 of mouse SIRT6 (NP_001156902.1).
Sequence	NLQPTKHDRQADLRIHGYVDEVMCRLMKHLGLEIPAWDGPCVLDKALPPLPRPVALKAEPPVHLNGAVHVSYKSKPNSPILHRPPKRVKTEAAPS
Gene ID
Swiss Prot
Synonyms	Sir2l6; mSIRT6; 2810449N18Rik
Calculated MW	39kDa
Observed MW	39-45kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa, 293T, Mouse spleen, Mouse stomach, A-549, LO2, BT-474, HL-60, Mouse heart
Cellular location	Nucleus, nucleoplasm
Customer validation	WB(Homo sapiens, Mus musculus)