SLC12A6 Rabbit pAb (A8180)

Datasheet

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

ABclonal:Immunofluorescence - SLC12A6 Rabbit pAb (A8180)

Immunofluorescence analysis of U2OS cells using SLC12A6 antibody (A8180) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	SLC12A6 Rabbit pAb
Catalog No.	A8180
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

This gene is a member of the K-Cl cotransporter (KCC) family. K-Cl cotransporters are integral membrane proteins that lower intracellular chloride concentrations below the electrochemical equilibrium potential. The proteins encoded by this gene are activated by cell swelling induced by hypotonic conditions. Alternate splicing results in multiple transcript variants encoding different isoforms. Mutations in this gene are associated with agenesis of the corpus callosum with peripheral neuropathy.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 60-190 of human SLC12A6 (NP_598408.1).
Sequence	MSEMSGATTSLATVALDPPSDRTSHPQDVIEDLSQNSITGEHSQLLDDGHKKARNAYLNNSNYEEGDEYFDKNLALFEEEMDTRPKVSSLLNRMANYTNLTQGAKEHEEAENITEGKKKPTKTPQMGTFMG
Gene ID
Swiss Prot
Synonyms	KCC3; ACCPN; KCC3A; KCC3B; CMT2II
Calculated MW	128kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Immunofluorescence
Positive samples
Cellular location	Basolateral cell membrane, Multi-pass membrane protein