제품 > 항체 > 다중클론항체(pAb)

SLC18A2 Rabbit pAb (A2799)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using SLC18A2 Rabbit pAb (A2799) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - SLC18A2 Rabbit pAb (A2799)

Immunohistochemistry analysis of paraffin-embedded Human appendix tissue using SLC18A2 Rabbit pAb (A2799) at a dilution of 1:100 (40x lens). Microwave antigen retrieval was performed with 0.01 M PBS buffer (pH 7.2±0.2) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human lung cancer tissue using SLC18A2 Rabbit pAb (A2799) at a dilution of 1:100 (40x lens). Microwave antigen retrieval was performed with 0.01 M PBS buffer (pH 7.2±0.2) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using SLC18A2 Rabbit pAb (A2799) at a dilution of 1:100 (40x lens). Microwave antigen retrieval was performed with 0.01 M PBS buffer (pH 7.2±0.2) prior to IHC staining.

Overview

Product name	SLC18A2 Rabbit pAb
Catalog No.	A2799
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes an transmembrane protein that functions as an ATP-dependent transporter of monoamines, such as dopamine, norepinephrine, serotonin, and histamine. This protein transports amine neurotransmitters into synaptic vesicles. Polymorphisms in this gene may be associated with schizophrenia, bipolar disorder, and other neurological/psychiatric ailments.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 50-130 of human SLC18A2 (NP_003045.2).
Sequence	SIKHEKNATEIQTARPVHTASISDSFQSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQ
Gene ID
Swiss Prot
Synonyms	SVAT; SVMT; VAT2; VMAT2; PKDYS2; SLC18A2
Calculated MW	56kDa
Observed MW	56kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IHC-P 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HeLa, Mouse lung, Rat stomach
Cellular location	Cytoplasmic vesicle membrane, Multi-pass membrane protein.