Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | SLC18A3 Rabbit pAb |
---|---|
Catalog No. | A16068 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 473-532 of human SLC18A3 (NP_003046.2). |
---|---|
Sequence | GLLTRSRSERDVLLDEPPQGLYDAVRLRERPVSGQDGEPRSPPGPFDACEDDYNYYYTRS |
Gene ID | |
Swiss Prot | |
Synonyms | CMS21; VACHT; SLC18A3 |
Calculated MW | 57kDa |
Observed MW | 65kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Immunohistochemistry Immunofluorescence |
Positive samples | Mouse brain, Rat brain |
Cellular location | Membrane, Multi-pass membrane protein |
Customer validation | IF(Canis familiaris) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A16068? Please let us know so that we can cite the reference in this datasheet.