제품 > 항체 > 다중클론항체(pAb)

SLC18A3 Rabbit pAb (A16068)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Immunohistochemistry analysis of paraffin-embedded rat brain using SLC18A3 Rabbit pAb (A16068) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - SLC18A3 Rabbit pAb (A16068)

Immunofluorescence analysis of paraffin-embedded mouse brain using SLC18A3 Rabbit pAb (A16068) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	SLC18A3 Rabbit pAb
Catalog No.	A16068
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene is a member of the vesicular amine transporter family. The encoded transmembrane protein transports acetylcholine into secretory vesicles for release into the extracellular space. Acetylcholine transport utilizes a proton gradient established by a vacuolar ATPase. This gene is located within the first intron of the choline acetyltransferase gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 473-532 of human SLC18A3 (NP_003046.2).
Sequence	GLLTRSRSERDVLLDEPPQGLYDAVRLRERPVSGQDGEPRSPPGPFDACEDDYNYYYTRS
Gene ID
Swiss Prot
Synonyms	CMS21; VACHT; SLC18A3
Calculated MW	57kDa
Observed MW	65kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Immunohistochemistry Immunofluorescence
Positive samples	Mouse brain, Rat brain
Cellular location	Membrane, Multi-pass membrane protein
Customer validation	IF(Canis familiaris)