제품 > 항체 > 단일클론항체(mAb)

SLC22A3/OCT3 Rabbit mAb (A19758)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using SLC22A3/OCT3 Rabbit mAb (A19758) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunohistochemistry - SLC22A3/OCT3 Rabbit mAb (A19758)

Immunohistochemistry analysis of paraffin-embedded human liver cancer using SLC22A3/OCT3 Rabbit mAb (A19758) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded mouse kidney using SLC22A3/OCT3 Rabbit mAb (A19758) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Overview

Product name	SLC22A3/OCT3 Rabbit mAb
Catalog No.	A19758
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2285

Background

Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 301-450 of human SLC22A3/OCT3 (O75751).
Sequence	GDKALQILRRIAKCNGKYLSSNYSEITVTDEEVSNPSFLDLVRTPQMRKCTLILMFAWFTSAVVYQGLVMRLGIIGGNLYIDFFISGVVELPGALLILLTIERLGRRLPFAASNIVAGVACLVTAFLPEGIAWLRTTVATLGRLGITMAF
Gene ID
Swiss Prot
Synonyms	EMT; EMTH; OCT3; SLC22A3/OCT3
Calculated MW	61kDa
Observed MW	61kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	PC-3, Mouse liver
Cellular location	Cell membrane, Apical cell membrane, Basolateral cell membrane, Mitochondrion membrane, Nucleus membrane, Nucleus outer membrane