제품 > 항체 > 다중클론항체(pAb)

SLC24A4 Rabbit pAb (A17254)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using SLC24A4 Rabbit pAb (A17254) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

Overview

Product name	SLC24A4 Rabbit pAb
Catalog No.	A17254
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables calcium, potassium:sodium antiporter activity. Involved in calcium ion transmembrane transport; potassium ion transmembrane transport; and sodium ion transmembrane transport. Acts upstream of or within cellular calcium ion homeostasis. Part of plasma membrane. Implicated in amelogenesis imperfecta hypomaturation type 2A5.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200-300 of human SLC24A4 (NP_705932.2).
Sequence	WWAVCRDSVYYTISVIVLIVFIYDEQIVWWEGLVLIILYVFYILIMKYNVKMQAFFTVKQKSIANGNPVNSELEAGNDFYDGSYDDPSVPLLGQVKEKPQY
Gene ID
Swiss Prot
Synonyms	AI2A5; NCKX4; SHEP6; SLC24A2; SLC24A4
Calculated MW	69kDa
Observed MW	69kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	U-87MG, A-549, SGC-7901, LO2
Cellular location	Cytoplasm, Membrane, Multi-pass membrane protein