Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | SLC25A12 Rabbit mAb |
---|---|
Catalog No. | A21129 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC3041 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 600-678 of human SLC25A12 (NP_003696.2). |
---|---|
Sequence | LLQRWFYIDFGGLKPAGSEPTPKSRIADLPPANPDHIGGYRLATATFAGIENKFGLYLPKFKSPSVAVVQPKAAVAATQ |
Gene ID | |
Swiss Prot | |
Synonyms | AGC1; DEE39; ARALAR; EIEE39; SLC25A12 |
Calculated MW | 75kDa |
Observed MW | 70kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunoprecipitation |
Positive samples | U-251MG, U-2 OS, Mouse brain, Mouse testis, Mouse skeletal muscle, Rat brain, Rat skeletal muscle, Rat heart |
Cellular location | Mitochondrion inner membrane, Multi-pass membrane protein |
Customer validation | WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A21129? Please let us know so that we can cite the reference in this datasheet.