제품 > 항체 > 단일클론항체(mAb)

SLC25A12 Rabbit mAb (A21129)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using SLC25A12 Rabbit mAb (A21129) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunoprecipitation - SLC25A12 Rabbit mAb (A21129)

Immunoprecipitation analysis of 600 μg extracts of Mouse brain using 3 μg SLC25A12 antibody (A21129). Western blot was performed from the immunoprecipitate using SLC25A12 antibody (A21129) at a dilution of1:1000.

Overview

Product name	SLC25A12 Rabbit mAb
Catalog No.	A21129
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC3041

Background

This gene encodes a calcium-binding mitochondrial carrier protein. The encoded protein localizes to the mitochondria and is involved in the exchange of aspartate for glutamate across the inner mitochondrial membrane. Polymorphisms in this gene may be associated with autism, and mutations in this gene may also be a cause of global cerebral hypomyelination. Alternatively spliced transcript variants have been observed for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 600-678 of human SLC25A12 (NP_003696.2).
Sequence	LLQRWFYIDFGGLKPAGSEPTPKSRIADLPPANPDHIGGYRLATATFAGIENKFGLYLPKFKSPSVAVVQPKAAVAATQ
Gene ID
Swiss Prot
Synonyms	AGC1; DEE39; ARALAR; EIEE39; SLC25A12
Calculated MW	75kDa
Observed MW	70kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IP 0.5μg-4μg antibody for 400μg-600μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	U-251MG, U-2 OS, Mouse brain, Mouse testis, Mouse skeletal muscle, Rat brain, Rat skeletal muscle, Rat heart
Cellular location	Mitochondrion inner membrane, Multi-pass membrane protein