제품 > 항체 > 다중클론항체(pAb)

SLC25A21 Rabbit pAb (A23865)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

Western blot analysis of lysates from K-562 cells, using SLC25A21 Rabbit pAb (A23865) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - SLC25A21 Rabbit pAb (A23865)

Immunohistochemistry analysis of SLC25A21 in paraffin-embedded human liver tissue using SLC25A21 Rabbit pAb (A23865) at a dilution of 1:50 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of SLC25A21 in paraffin-embedded rat kidney tissue using SLC25A21 Rabbit pAb (A23865) at a dilution of 1:50 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Overview

Product name	SLC25A21 Rabbit pAb
Catalog No.	A23865
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

SLC25A21 is a homolog of the S. cerevisiae ODC proteins, mitochondrial carriers that transport C5-C7 oxodicarboxylates across inner mitochondrial membranes. One of the species transported by ODC is 2-oxoadipate, a common intermediate in the catabolism of lysine, tryptophan, and hydroxylysine in mammals. Within mitochondria, 2-oxoadipate is converted into acetyl-CoA.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 148-247 of human SLC25A21(NP_085134.1).
Sequence	PSTVGYARQIIKKEGWGLQGLNKGLTATLGRHGVFNMVYFGFYYNVKNMIPVNKDPILEFWRKFGIGLLSGTIASVINIPFDVAKSRIQGPQPVPGEIKY
Gene ID
Swiss Prot
Synonyms	ODC; ODC1; MTDPS18; SLC25A21
Calculated MW	33kDa
Observed MW	33kDa

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:100 - 1:500 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	K-562
Cellular location	Mitochondrion