Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Rat
Product name | SLC38A1 Rabbit pAb |
---|---|
Catalog No. | A20717 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human SLC38A1 (NP_001070952.1). |
---|---|
Sequence | MMHFKSGLELTELQNMTVPEDDNISNDSNDFTEVENGQINSKFISDRESRRSLTNSHLEKKKCDEYIPGT |
Gene ID | |
Swiss Prot | |
Synonyms | ATA1; NAT2; SAT1; SNAT1; SLC38A1 |
Calculated MW | 54kDa |
Observed MW | 50-70kDa |
Reactivity | Human, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | A-549, Rat heart |
Cellular location | basolateral plasma membrane, external side of apical plasma membrane, extracellular exosome, plasma membrane |
Customer validation | WB(Capra hircus) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A20717? Please let us know so that we can cite the reference in this datasheet.