Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | SLC40A1 Rabbit pAb |
---|---|
Catalog No. | A14884 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 250-300 of human SLC40A1 (NP_055400.1). |
---|---|
Sequence | NLHKDTEPKPLEGTHLMGVKDSNIHELEHEQEPTCASQMAEPFRTFRDGWV |
Gene ID | |
Swiss Prot | |
Synonyms | FPN; FPN1; HFE4; MTP1; IREG1; MST079; MSTP079; SLC11A3; SLC40A1 |
Calculated MW | 63kDa |
Observed MW | 62-70kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HCT116, HEL |
Cellular location | Cell membrane, Multi-pass membrane protein |
Customer validation | WB(Homo sapiens, Pelteobagrus fulvidraco, Mus musculus, Rattus norvegicus, Mus musculusRattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A14884? Please let us know so that we can cite the reference in this datasheet.