Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Western blot analysis of various lysates, using SLC40A1 Rabbit pAb (A14884) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
| Product name | SLC40A1 Rabbit pAb |
|---|---|
| Catalog No. | A14884 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 250-300 of human SLC40A1 (NP_055400.1). |
|---|---|
| Sequence | NLHKDTEPKPLEGTHLMGVKDSNIHELEHEQEPTCASQMAEPFRTFRDGWV |
| Gene ID | |
| Swiss Prot | |
| Synonyms | FPN; FPN1; HFE4; MTP1; IREG1; MST079; MSTP079; SLC11A3; SLC40A1 |
| Calculated MW | 63kDa |
| Observed MW | 62-70kDa |
| Reactivity | Human |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | HCT116, HEL |
| Cellular location | Cell membrane, Multi-pass membrane protein |
| Customer validation | WB(Homo sapiens, Pelteobagrus fulvidraco, Mus musculus, Rattus norvegicus, Mus musculusRattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A14884? Please let us know so that we can cite the reference in this datasheet.
