Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Western blot analysis of various lysates using SLC40A1 Rabbit pAb (A14885) at 1:400 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
| Product name | SLC40A1 Rabbit pAb |
|---|---|
| Catalog No. | A14885 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-270 of human SLC40A1 (NP_055400.1). |
|---|---|
| Sequence | SPVIGCGFISGWNLVSMCVEYVLLWKVYQKTPALAVKAGLKEEETELKQLNLHKDTEPKPLEGTHLMGVKD |
| Gene ID | |
| Swiss Prot | |
| Synonyms | FPN; FPN1; HFE4; MTP1; IREG1; MST079; MSTP079; SLC11A3; SLC40A1 |
| Calculated MW | 63kDa |
| Observed MW | 63kDa |
| Reactivity | Human, Mouse |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | HEL |
| Cellular location | Cell membrane, Multi-pass membrane protein. |
| Customer validation | WB(Gallus gallus, Rattus norvegicus, Homo sapiens, Mus musculus, Mus musculus, Danio rerio, Capra hircus, Other) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A14885? Please let us know so that we can cite the reference in this datasheet.
