제품 > 항체 > 다중클론항체(pAb)

SLC44A1 Rabbit pAb (A15413)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using SLC44A1 Rabbit pAb (A15413) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Overview

Product name	SLC44A1 Rabbit pAb
Catalog No.	A15413
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables choline transmembrane transporter activity. Involved in choline transport and transmembrane transport. Located in several cellular components, including cytosol; mitochondrion; and nucleoplasm. Implicated in high grade glioma.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 55-210 of human SLC44A1 (NP_536856.2).
Sequence	AARLVSGYDSYGNICGQKNTKLEAIPNSGMDHTQRKYVFFLDPCNLDLINRKIKSVALCVAACPRQELKTLSDVQKFAEINGSALCSYNLKPSEYTTSPKSSVLCPKLPVPASAPIPFFHRCAPVNISCYAKFAEALITFVSDNSVLHRLISGVMT
Gene ID
Swiss Prot
Synonyms	CD92; CTL1; CDW92; CHTL1; CONATOC; SLC44A1
Calculated MW	73kDa
Observed MW	80kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:200 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa, A-549, LO2, mouse liver, mouse brain, mouse kidney, rat liver
Cellular location	Cell membrane, Mitochondrion outer membrane, Multi-pass membrane protein