제품 > 항체 > 다중클론항체(pAb)

SLC47A1 Rabbit pAb (A14559)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

Western blot analysis of lysates from rat liver, using SLC47A1 Rabbit pAb (A14559) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Overview

Product name	SLC47A1 Rabbit pAb
Catalog No.	A14559
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene is located within the Smith-Magenis syndrome region on chromosome 17. It encodes a protein of unknown function.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 460-550 of human SLC47A1 (NP_060712.2).
Sequence	LNWKKACQQAQVHANLKVNNVPRSGNSALPQDPLHPGCPENLEGILTNDVGKTGEPQSDQQMRQEEPLPEHPQDGAKLSRKQLVLRRGLLL
Gene ID
Swiss Prot
Synonyms	MATE1; SLC47A1
Calculated MW	62kDa
Observed MW	62kDa

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Rat liver
Cellular location	Cell membrane, Multi-pass membrane protein
Customer validation	WB(Rattus norvegicus)