Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | SLC5A11 Rabbit pAb |
---|---|
Catalog No. | A13164 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 540-640 of human SLC5A11 (NP_443176.2). |
---|---|
Sequence | SWFTEPPSKEMVSHLTWFTRHDPVVQKEQAPPAAPLSLTLSQNGMPEASSSSSVQFEMVQENTSKTHSCDMTPKQSKVVKAILWLCGIQEKGKEELPARAE |
Gene ID | |
Swiss Prot | |
Synonyms | KST1; RKST1; SGLT6; SMIT2; SLC5A11 |
Calculated MW | 74kDa |
Observed MW | 74kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | 293T, U-87MG, Mouse kidney, Rat brain |
Cellular location | Membrane, Multi-pass membrane protein |
Customer validation | WB(Sus scrofa) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A13164? Please let us know so that we can cite the reference in this datasheet.