제품 > 항체 > 다중클론항체(pAb)

SLC6A9 Rabbit pAb (A16203)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using SLC6A9 antibody (A16203) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Overview

Product name	SLC6A9 Rabbit pAb
Catalog No.	A16203
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The amino acid glycine acts as an inhibitory neurotransmitter in the central nervous system. The protein encoded by this gene is one of two transporters that stop glycine signaling by removing it from the synaptic cleft.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human SLC6A9 (NP_964012.2).
Sequence	MSGGDTRAAIARPRMAAAHGPVAPSSPEQVTLLPVQRSFFLPPFSGATPSTSLAESVLKVWHGAYNSGLLPQLMAQHSLAMAQNGAVPSEATKRDQNLKRGNWGNQIEFV
Gene ID
Swiss Prot
Synonyms	GLYT1; GCENSG
Calculated MW	78kDa
Observed MW	75kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	MCF7, K-562, Mouse liver, C6
Cellular location	apical plasma membrane, basal plasma membrane, basolateral plasma membrane, endosome, hippocampal mossy fiber to CA3 synapse, lateral plasma membrane, parallel fiber to Purkinje cell synapse, plasma membrane, postsynaptic density, postsynaptic membrane, presynaptic membrane, synaptic vesicle membrane
Customer validation	WB(Homo sapiens, Mus musculus)