제품 > 항체 > 다중클론항체(pAb)

SLC7A8 Rabbit pAb (A14861)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using SLC7A8 Rabbit pAb (A14861) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Overview

Product name	SLC7A8 Rabbit pAb
Catalog No.	A14861
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables several functions, including neutral amino acid transmembrane transporter activity; thyroid hormone transmembrane transporter activity; and toxin transmembrane transporter activity. Involved in L-alanine import across plasma membrane; L-leucine import across plasma membrane; and thyroid hormone transport. Located in plasma membrane. Part of basolateral plasma membrane and microvillus membrane.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 150-250 of human SLC7A8 (NP_036376.2).
Sequence	LFPTCFPPESGLRLLAAICLLLLTWVNCSSVRWATRVQDIFTAGKLLALALIIIMGIVQICKGEYFWLEPKNAFENFQEPDIGLVALAFLQGSFAYGGWNF
Gene ID
Swiss Prot
Synonyms	LAT2; LPI-PC1; SLC7A8
Calculated MW	58kDa
Observed MW	58kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa, A375
Cellular location	Basolateral cell membrane, Cytoplasm, Multi-pass membrane protein
Customer validation	WB(Homo sapiens)