제품 > 항체 > 단일클론항체(mAb)

SLP2 Rabbit mAb (A20883)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using SLP2 antibody (A20883) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - SLP2 Rabbit mAb (A20883)

Immunofluorescence analysis of MCF7 using SLP2 antibody (A20883) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	SLP2 Rabbit mAb
Catalog No.	A20883
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2830

Background

Enables GTPase binding activity and cardiolipin binding activity. Involved in several processes, including inorganic cation transmembrane transport; positive regulation of cardiolipin metabolic process; and positive regulation of mitochondrial DNA replication. Located in membrane raft; mitochondrial inner membrane; and mitochondrial intermembrane space. Is extrinsic component of plasma membrane. Colocalizes with several cellular components, including COP9 signalosome; T cell receptor complex; and immunological synapse.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 10-130 of human SLP2 (Q9UJZ1).
Sequence	GALLLRGSLLASGRAPRRASSGLPRNTVVLFVPQQEAWVVERMGRFHRILEPGLNILIPVLDRIRYVQSLKEIVINVPEQSAVTLDNVTLQIDGVLYLRIMDPYKASYGVEDPEYAVTQLA
Gene ID
Swiss Prot
Synonyms	SLP-2; HSPC108
Calculated MW	39kDa
Observed MW	40kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HepG2, A549, Jurkat, Mouse liver, Rat brain
Cellular location	Cell membrane, Membrane raft, Mitochondrion inner membrane, Mitochondrion intermembrane space, Peripheral membrane protein