Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | SMAD2/SMAD3 Rabbit pAb |
---|---|
Catalog No. | A7536 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human SMAD2/SMAD3 (NP_005892.1). |
---|---|
Sequence | EYAFNLKKDEVCVNPYHYQRVETPVLPPVLVPRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELS |
Gene ID | |
Swiss Prot | |
Synonyms | HSPC193; HsT17436; JV15-2; LDS1C; LDS3; MADH3; SMAD2/SMAD3 |
Calculated MW | 48kDa/52kDa/25kDa/35kDa/43kDa |
Observed MW | 60kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | HeLa, 293T |
Cellular location | Cytoplasm, Nucleus |
Customer validation | WB(Mus musculus, Homo sapiens, Rattus norvegicus, Gallus gallus, Canis familiaris) IHC(Mus musculus) IHC(Mus musculus) IF(Gallus gallus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A7536? Please let us know so that we can cite the reference in this datasheet.