제품 > 항체 > 다중클론항체(pAb)

SMC2 Rabbit pAb (A17867)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using SMC2 Rabbit pAb (A17867) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Overview

Product name	SMC2 Rabbit pAb
Catalog No.	A17867
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable ATP binding activity; chromatin binding activity; and single-stranded DNA binding activity. Involved in mitotic chromosome condensation. Located in condensed chromosome; cytoplasm; and nuclear lumen. Part of condensin complex.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 700-900 of human SMC2 (NP_006435.2).
Sequence	EELAGLKNTAEKYRQLKQQWEMKTEEADLLQTKLQQSSYHKQQEELDALKKTIEESEETLKNTKEIQRKAEEKYEVLENKMKNAEAERERELKDAQKKLDCAKTKADASSKKMKEKQQEVEAITLELEELKREHTSYKQQLEAVNEAIKSYESQIEVMAAEVAKNKESVNKAQEEVTKQKEVITAQDTVIKAKYAEVAKHK
Gene ID
Swiss Prot
Synonyms	CAPE; CAP-E; SMC-2; SMC2L1; SMC2
Calculated MW	136kDa
Observed MW	135kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	MCF7, Raji, U-87MG, Mouse kidney, Mouse liver
Cellular location	Chromosome, Cytoplasm, Nucleus
Customer validation	WB(Homo sapiens)