제품 > 항체 > 단일클론항체(mAb)

SMC3 Rabbit mAb (A19591)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using SMC3 Rabbit mAb (A19591) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - SMC3 Rabbit mAb (A19591)

Immunofluorescence analysis of U2OS cells using SMC3 Rabbit mAb (A19591) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH/3T3 cells using SMC3 Rabbit mAb (A19591) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of C6 cells using SMC3 Rabbit mAb (A19591) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - SMC3 Rabbit mAb (A19591)

Immunoprecipitation analysis of 300 μg extracts of U-87MG cells using 3 μg SMC3 antibody (A19591). Western blot was performed from the immunoprecipitate using SMC3 antibody (A19591) at a dilution of 1:1000.

Overview

Product name	SMC3 Rabbit mAb
Catalog No.	A19591
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2186

Background

This gene belongs to the SMC3 subfamily of SMC proteins. The encoded protein occurs in certain cell types as either an intracellular, nuclear protein or a secreted protein. The nuclear form, known as structural maintenance of chromosomes 3, is a component of the multimeric cohesin complex that holds together sister chromatids during mitosis, enabling proper chromosome segregation. Post-translational modification of the encoded protein by the addition of chondroitin sulfate chains gives rise to the secreted proteoglycan bamacan, an abundant basement membrane protein.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1118-1217 of human SMC3 (NP_005436.1).
Sequence	GQKSLVALALIFAIQKCDPAPFYLFDEIDQALDAQHRKAVSDMIMELAVHAQFITTTFRPELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTHG
Gene ID
Swiss Prot
Synonyms	BAM; BMH; HCAP; CDLS3; CSPG6; SMC3L1; SMC3
Calculated MW	142kDa
Observed MW	142kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	HeLa, NIH/3T3, Jurkat, C6, U-87MG, Mouse brain, Mouse spleen
Cellular location	Nucleus, Chromosome, Chromosome, centromere .