Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | SMC3 Rabbit mAb |
---|---|
Catalog No. | A19591 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC2186 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1118-1217 of human SMC3 (NP_005436.1). |
---|---|
Sequence | GQKSLVALALIFAIQKCDPAPFYLFDEIDQALDAQHRKAVSDMIMELAVHAQFITTTFRPELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTHG |
Gene ID | |
Swiss Prot | |
Synonyms | BAM; BMH; HCAP; CDLS3; CSPG6; SMC3L1; SMC3 |
Calculated MW | 142kDa |
Observed MW | 142kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence Immunoprecipitation |
Positive samples | HeLa, NIH/3T3, Jurkat, C6, U-87MG, Mouse brain, Mouse spleen |
Cellular location | Nucleus, Chromosome, Chromosome, centromere . |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.