Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of extracts of various cell lines, using SMC4 Rabbit mAb (A3559) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunofluorescence analysis of C6 cells using SMC4 Rabbit mAb (A3559) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using SMC4 Rabbit mAb (A3559) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
| Product name | SMC4 Rabbit mAb |
|---|---|
| Catalog No. | A3559 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC2042 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1189-1288 of human SMC4 (Q9NTJ3). |
|---|---|
| Sequence | FNLSGGEKTLSSLALVFALHHYKPTPLYFMDEIDAALDFKNVSIVAFYIYEQTKNAQFIIISLRNNMFEISDRLIGIYKTYNITKSVAVNPKEIASKGLC |
| Gene ID | |
| Swiss Prot | |
| Synonyms | CAPC; CAP-C; SMC-4; SMC4L1 |
| Calculated MW | 147kDa |
| Observed MW | 180kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence |
| Positive samples | HT-29, NIH/3T3, Raji, C6, Mouse testis, Mouse thymus, Rat testis |
| Cellular location | Chromosome, Cytoplasm, Nucleus |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
