SMG1 Rabbit pAb (A21169)

Datasheet

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

ABclonal:Immunofluorescence - SMG1 Rabbit pAb (A21169)

Immunofluorescence analysis of NIH/3T3 cells using SMG1 Rabbit pAb (A21169) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of PC-12 cells using SMG1 Rabbit pAb (A21169) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U2OS cells using SMG1 Rabbit pAb (A21169) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	SMG1 Rabbit pAb
Catalog No.	A21169
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

This gene encodes a protein involved in nonsense-mediated mRNA decay (NMD) as part of the mRNA surveillance complex. The protein has kinase activity and is thought to function in NMD by phosphorylating the regulator of nonsense transcripts 1 protein. Alternatively spliced transcript variants have been described, but their full-length nature has yet to be determined.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SMG1 (NP_055907.3).
Sequence	MSRRAPGSRLSSGGGGGGTKYPRSWNDWQPRTDSASADPDNLKYSSSRDRGGSSSYGLQPSNSAVVSRQRHDDTRVHADIQNDEKGGYSVNGGSGENTYG
Gene ID
Swiss Prot
Synonyms	ATX; LIP; 61E3.4
Calculated MW	411kDa
Observed MW	Refer to figures

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Immunofluorescence
Positive samples
Cellular location	chromatoid body, cytoplasm, cytosol, nucleoplasm, nucleus