Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Rat
Product name | SMN1 Rabbit mAb |
---|---|
Catalog No. | A9707 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC1710 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 103-200 of human SMN1 (Q16637). |
---|---|
Sequence | SEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPM |
Gene ID | |
Swiss Prot | |
Synonyms | SMA; SMN; SMA1; SMA2; SMA3; SMA4; SMA@; SMNT; BCD541; GEMIN1; TDRD16A; T-BCD541; SMN1 |
Calculated MW | 32kDa |
Observed MW | 38kDa |
Reactivity | Human, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | HeLa, HepG2 |
Cellular location | Cajal body, Cytoplasm, Cytoplasmic ribonucleoprotein granule, Cytosol, Gemini of coiled bodies, Nuclear body, Nucleoplasm, Nucleus, SMN-Sm protein complex, Z disc |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.