제품 > 항체 > 단일클론항체(mAb)

SMURF2 Rabbit mAb (A2278)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using SMURF2 Rabbit mAb (A2278) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.

ABclonal:Immunohistochemistry - SMURF2 Rabbit mAb (A2278)

Immunohistochemistry analysis of paraffin-embedded Human colon using SMURF2 Rabbit mAb (A2278) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunofluorescence - SMURF2 Rabbit mAb (A2278)

Immunofluorescence analysis of NIH-3T3 cells using SMURF2 Rabbit mAb (A2278) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - SMURF2 Rabbit mAb (A2278)

Immunoprecipitation analysis of 300 μg extracts of Mouse lung using 3 μg SMURF2 antibody (A2278). Western blot was performed from the immunoprecipitate using SMURF2 antibody (A2278) at a dilution of 1:1000.

Overview

Product name	SMURF2 Rabbit mAb
Catalog No.	A2278
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1897

Background

Enables SMAD binding activity; identical protein binding activity; and ubiquitin-protein transferase activity. Involved in negative regulation of transforming growth factor beta receptor signaling pathway; positive regulation of trophoblast cell migration; and ubiquitin-dependent SMAD protein catabolic process. Located in nuclear speck. Part of ubiquitin ligase complex.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 201-290 of human SMURF2 (Q9HAU4).
Sequence	PLSCFVDENTPISGTNGATCGQSSDPRLAERRVRSQRHRNYMSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSN
Gene ID
Swiss Prot
Synonyms	SMURF2; E3 ubiquitin-protein ligase SMURF2
Calculated MW	86kDa
Observed MW	80kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:200 - 1:800 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 400μg-600μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	U2OS, MCF7, SH-SY5Y, Mouse lung, Mouse testis, Mouse brain
Cellular location	Cell membrane, Cytoplasm, Membrane raft, Nucleus.
Customer validation	WB(Homo sapiens, Mus musculus) PCR(Homo sapiens) IF(Homo sapiens) IHC(Homo sapiens) WB(Homo sapiens)