제품 > 항체 > 다중클론항체(pAb)

SMURF2 Rabbit pAb (A10592)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of extracts of SW480 cells, using SMURF2 antibody (A10592) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Overview

Product name	SMURF2 Rabbit pAb
Catalog No.	A10592
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables SMAD binding activity; identical protein binding activity; and ubiquitin-protein transferase activity. Involved in negative regulation of transforming growth factor beta receptor signaling pathway; positive regulation of trophoblast cell migration; and ubiquitin-dependent SMAD protein catabolic process. Located in nuclear speck. Part of ubiquitin ligase complex.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 150-250 of human SMURF2 (NP_073576.1).
Sequence	DCSRLFDNDLPDGWEERRTASGRIQYLNHITRTTQWERPTRPASEYSSPGRPLSCFVDENTPISGTNGATCGQSSDPRLAERRVRSQRHRNYMSRTHLHTP
Gene ID
Swiss Prot
Synonyms	SMURF2
Calculated MW	86kDa
Observed MW	86kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	SW480
Cellular location	Cell membrane, Cytoplasm, Membrane raft, Nucleus
Customer validation	WB(Homo sapiens) IHC(Homo sapiens)