Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | SMURF2 Rabbit pAb |
---|---|
Catalog No. | A10592 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 150-250 of human SMURF2 (NP_073576.1). |
---|---|
Sequence | DCSRLFDNDLPDGWEERRTASGRIQYLNHITRTTQWERPTRPASEYSSPGRPLSCFVDENTPISGTNGATCGQSSDPRLAERRVRSQRHRNYMSRTHLHTP |
Gene ID | |
Swiss Prot | |
Synonyms | SMURF2 |
Calculated MW | 86kDa |
Observed MW | 86kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | SW480 |
Cellular location | Cell membrane, Cytoplasm, Membrane raft, Nucleus |
Customer validation | WB(Homo sapiens) IHC(Homo sapiens) IP(Mus musculus) WB(Mus musculus) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A10592? Please let us know so that we can cite the reference in this datasheet.