제품 > 항체 > 단일클론항체(mAb)

SNX4 Rabbit mAb (A21130)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates, using SNX4 Rabbit mAb (A21130) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunoprecipitation - SNX4 Rabbit mAb (A21130)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg SNX4 antibody (A21130). Western blot was performed from the immunoprecipitate using SNX4 antibody (A21130) at a dilution of1:1000.

Overview

Product name	SNX4 Rabbit mAb
Catalog No.	A21130
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC3028

Background

This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein associated with the long isoform of the leptin receptor and with receptor tyrosine kinases for platelet-derived growth factor, insulin, and epidermal growth factor in cell cultures, but its function is unknown. This protein may form oligomeric complexes with family members. Two transcript variants, one protein coding and the other non-protein coding, have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 321-400 of human SNX4 (NP_003785.1).
Sequence	HELMQYDLEMAAQDLASKKQQCEELVTGTVRTFSLKGMTTKLFGQETPEQREARIKVLEEQINEGEQQLKSKNLEGREFV
Gene ID
Swiss Prot
Synonyms	ATG24B; SNX4
Calculated MW	52kDa
Observed MW	58kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	HeLa, Jurkat, NIH/3T3, Mouse heart
Cellular location	Cytoplasmic side, Early endosome membrane, Peripheral membrane protein