Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | SON Rabbit pAb |
---|---|
Catalog No. | A16323 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 850-950 of human SON (NP_001278340.1). |
---|---|
Sequence | TMDSQMLATSSMDSQMLASGTMDSQMLASGTMDAQMLASGTMDAQMLASSTQDSAMLGSKSPDPYRLAQDPYRLAQDPYRLGHDPYRLGHDAYRLGQDPYR |
Gene ID | |
Swiss Prot | |
Synonyms | SON3; BASS1; DBP-5; NREBP; TOKIMS; C21orf50; SON |
Calculated MW | 264kDa |
Observed MW | 250kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | LO2, HeLa |
Cellular location | nuclear speck |
Customer validation | IF(Homo sapiens) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A16323? Please let us know so that we can cite the reference in this datasheet.