제품 > 항체 > 단일클론항체(mAb)

SOX11 Rabbit mAb (A22052)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using SOX11 Rabbit mAb (A22052) at1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Overview

Product name	SOX11 Rabbit mAb
Catalog No.	A22052
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC54700

Background

This intronless gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may function in the developing nervous system and play a role in tumorigenesis.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SOX11 (NP_003099.1).
Sequence	MVQQAESLEAESNLPREALDTEEGEFMACSPVALDESDPDWCKTASGHIKRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIR
Gene ID
Swiss Prot
Synonyms	CSS9; MRD27; IDDMOH; SOX11
Calculated MW	47kDa
Observed MW	60kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:20000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	NIH/3T3, Y79, Neuro-2a, Mouse brain, Rat brain
Cellular location	Nucleus