제품 > 항체 > 다중클론항체(pAb)

SOX5 Rabbit pAb (A6985)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from Mouse brain, using SOX5 Rabbit pAb (A6985) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - SOX5 Rabbit pAb (A6985)

Immunohistochemistry analysis of paraffin-embedded Mouse embryos using SOX5 Rabbit pAb (A6985) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - SOX5 Rabbit pAb (A6985)

Immunofluorescence analysis of MCF7 cells using SOX5 Rabbit pAb (A6985).Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution.

Overview

Product name	SOX5 Rabbit pAb
Catalog No.	A6985
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The encoded protein may play a role in chondrogenesis. A pseudogene of this gene is located on chromosome 8. Multiple transcript variants encoding distinct isoforms have been identified for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-120 of human SOX5 (NP_694534.1).
Sequence	MSSKRPASPYGEADGEVAMVTSRQKVEEEESDGLPAFHLPLHVSFPNKPHSEEFQPVSLLTQETCGHRTPTSQHNTMEVDGNKVMSSFAPHNSSTSPQKAEEGGRQSGESLSSTALGTPE
Gene ID
Swiss Prot
Synonyms	L-SOX5; LAMSHF; L-SOX5B; L-SOX5F; SOX5
Calculated MW	84kDa
Observed MW	84kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:100 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	Mouse brain
Cellular location	Nucleus.
Customer validation	IF(Homo sapiens) IHC(Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

연구후성유전학 & 핵 신호전달전사 인자

SOX5 Rabbit pAb images

Western blot - SOX5 Rabbit pAb (A6985)

Immunohistochemistry - SOX5 Rabbit pAb (A6985)

Immunofluorescence - SOX5 Rabbit pAb (A6985)

Immunofluorescence analysis of MCF7 cells using SOX5 Rabbit pAb (A6985).Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution.

* For research use only. Not for therapeutic or diagnostic purposes.