Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | SOX9 Rabbit pAb |
---|---|
Catalog No. | A2479 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 250-339 of human SOX9 (NP_000337.1). |
---|---|
Sequence | ADLKREGRPLPEGGRQPPIDFRDVDIGELSSDVISNIETFDVNEFDQYLPPNGHPGVPATHGQVTYTGSYGISSTAATPASAGHVWMSKQ |
Gene ID | |
Swiss Prot | |
Synonyms | CMD1; SRA1; CMPD1; SRXX2; SRXY10; SOX9 |
Calculated MW | 56kDa |
Observed MW | 70kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | HepG2, Mouse testis, Mouse brain, Rat testis, Rat kidney, Rat brain |
Cellular location | Nucleus. |
Customer validation | IHC(Mus musculus) WB(Homo sapiens, Sus scrofa, Rattus norvegicus, Gallus gallus) IF(Homo sapiens) IHC(Gallus gallus) IF(Gallus gallus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A2479? Please let us know so that we can cite the reference in this datasheet.