Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using SOX9 Rabbit pAb (A2479) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 120s.
Immunohistochemistry analysis of paraffin-embedded human thyroid cancer using SOX9 Rabbit pAb (A2479) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human colon using SOX9 Rabbit pAb (A2479) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
| Product name | SOX9 Rabbit pAb |
|---|---|
| Catalog No. | A2479 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 250-339 of human SOX9 (NP_000337.1). |
|---|---|
| Sequence | ADLKREGRPLPEGGRQPPIDFRDVDIGELSSDVISNIETFDVNEFDQYLPPNGHPGVPATHGQVTYTGSYGISSTAATPASAGHVWMSKQ |
| Gene ID | |
| Swiss Prot | |
| Synonyms | CMD1; SRA1; CMPD1; SRXX2; SRXY10; SOX9 |
| Calculated MW | 56kDa |
| Observed MW | 70kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry |
| Positive samples | HepG2, Mouse testis, Mouse brain, Rat testis, Rat kidney, Rat brain |
| Cellular location | Nucleus |
| Customer validation | IHC(Mus musculus) WB(Homo sapiens, Sus scrofa, Rattus norvegicus, Gallus gallus) IF(Homo sapiens) IHC(Gallus gallus) IF(Gallus gallus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A2479? Please let us know so that we can cite the reference in this datasheet.
_WB_01.jpg?t=1715048675 "ABclonal:Western blot - SOX9 Rabbit pAb (A2479)")
