Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | SPAG6 Rabbit pAb |
---|---|
Catalog No. | A3088 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 180-290 of human SPAG6 (NP_758442.1). |
---|---|
Sequence | EIALKRIAASALSDIAKHSPELAQTVVDAGAVAHLAQMILNPDAKLKHQILSALSQVSKHSVDLAEMVVEAEIFPVVLTCLKDKDEYVKKNASTLIREIAKHTPELSQLVV |
Gene ID | |
Swiss Prot | |
Synonyms | pf16; CT141; FAP194; CFAP194; Repro-SA-1; SPAG6 |
Calculated MW | 55kDa |
Observed MW | 55kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Jurkat, PC-3 |
Cellular location | Cell projection, Cytoplasm, cilium, cytoskeleton, flagellum |
* For research use only. Not for therapeutic or diagnostic purposes.