SPINK1 Rabbit pAb (A13546)

Datasheet

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

ABclonal:Immunofluorescence - SPINK1 Rabbit pAb (A13546)

Immunofluorescence analysis of HeLa cells using SPINK1 antibody (A13546). Blue: DAPI for nuclear staining.

Overview

Product name	SPINK1 Rabbit pAb
Catalog No.	A13546
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

The protein encoded by this gene is a trypsin inhibitor, which is secreted from pancreatic acinar cells into pancreatic juice. It is thought to function in the prevention of trypsin-catalyzed premature activation of zymogens within the pancreas and the pancreatic duct. Mutations in this gene are associated with hereditary pancreatitis and tropical calcific pancreatitis.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 24-79 of human SPINK1 (NP_003113.2).
Sequence	DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC
Gene ID
Swiss Prot
Synonyms	TCP; PCTT; PSTI; TATI; Spink3
Calculated MW	9kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Immunofluorescence
Positive samples
Cellular location	Secreted