제품 > 항체 > 다중클론항체(pAb)

SPOP Rabbit pAb (A7621)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of extracts of various cell lines, using SPOP antibody (A7621) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Overview

Product name	SPOP Rabbit pAb
Catalog No.	A7621
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables RNA polymerase II-specific DNA-binding transcription factor binding activity. Acts upstream of or within several processes, including glucose homeostasis; positive regulation of apoptotic process; and regulation of transcription, DNA-templated. Located in nuclear speck. Is expressed in lung; metanephros; and pancreas. Orthologous to human SPOP (speckle type BTB/POZ protein).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of mouse SPOP (NP_079563.2).
Sequence	MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMA
Gene ID
Swiss Prot
Synonyms	TEF2; Pcif1
Calculated MW	42kDa
Observed MW	42kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	BT-474, Mouse pancreas
Cellular location	Nucleus, Nucleus speckle
Customer validation	WB(Homo sapiens)