Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse
Product name | SPRED1 Rabbit pAb |
---|---|
Catalog No. | A14970 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 120-320 of human SPRED1 (NP_689807.1). |
---|---|
Sequence | IEDISQGCPESKNEAEGADDLQANEEDSSSSLVKDHLFQQETVVTSEPYRSSNIRPSPFEDLNARRVYMQSQANQITFGQPGLDIQSRSMEYVQRQISKECGSLKSQNRVPLKSIRHVSFQDEDEIVRINPRDILIRRYADYRHPDMWKNDLERDDADSSIQFSKPDSKKSDYLYSCGDETKLSSPKDSVVFKTQPSSLKI |
Gene ID | |
Swiss Prot | |
Synonyms | LGSS; NFLS; hSpred1; spred-1; PPP1R147; SPRED1 |
Calculated MW | 50kDa |
Observed MW | 50kDa |
Reactivity | Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse brain |
Cellular location | Cell membrane, Membrane, Nucleus, Peripheral membrane protein, caveola |
* For research use only. Not for therapeutic or diagnostic purposes.