제품 > 항체 > 단일클론항체(mAb)

SQS/FDFT1 Rabbit mAb (A4651)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using SQS/FDFT1 Rabbit mAb (A4651) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

Western blot analysis of extracts of Mouse kidney, using SQS/FDFT1 Rabbit mAb (A4651) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Review

Overview

Product name	SQS/FDFT1 Rabbit mAb
Catalog No.	A4651
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1077

Background

This gene encodes a membrane-associated enzyme located at a branch point in the mevalonate pathway. The encoded protein is the first specific enzyme in cholesterol biosynthesis, catalyzing the dimerization of two molecules of farnesyl diphosphate in a two-step reaction to form squalene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 150-250 of human SQS/FDFT1 (P37268).
Sequence	MGIGMAEFLDKHVTSEQEWDKYCHYVAGLVGIGLSRLFSASEFEDPLVGEDTERANSMGLFLQKTNIIRDYLEDQQGGREFWPQEVWSRYVKKLGDFAKPE
Gene ID
Swiss Prot
Synonyms	SS; SQS; DGPT; ERG9; SQSD
Calculated MW	48kDa
Observed MW	48kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa, A-549, U-251MG, Mouse kidney, Rat liver
Cellular location	Endoplasmic reticulum membrane, Multi-pass membrane protein
Customer validation	(HeLa、MOLT-4、Jurkat、HepG2、 U2-OS、 PC-3)