제품 > 항체 > 단일클론항체(mAb)

SR-B2/LIMPII Rabbit mAb (A9185)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using SR-B2/SR-B2/LIMPII Rabbit mAb (A9185) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - SR-B2/LIMPII Rabbit mAb (A9185)

Immunohistochemistry analysis of SR-B2/LIMPII in paraffin-embedded human liver tissue using SR-B2/LIMPII Rabbit mAb (A9185) at a dilution of 1:1000 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of SR-B2/LIMPII in paraffin-embedded Human lung adenocarcinoma tissue using SR-B2/LIMPII Rabbit mAb (A9185) at a dilution of 1:1000 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of SR-B2/LIMPII in paraffin-embedded human thyroid cancer tissue using SR-B2/LIMPII Rabbit mAb (A9185) at a dilution of 1:1000 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of SR-B2/LIMPII in paraffin-embedded mouse kidney tissue using SR-B2/LIMPII Rabbit mAb (A9185) at a dilution of 1:1000 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of SR-B2/LIMPII in paraffin-embedded mouse spleen tissue using SR-B2/LIMPII Rabbit mAb (A9185) at a dilution of 1:1000 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of SR-B2/LIMPII in paraffin-embedded rat kidney tissue using SR-B2/LIMPII Rabbit mAb (A9185) at a dilution of 1:1000 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Overview

Product name	SR-B2/LIMPII Rabbit mAb
Catalog No.	A9185
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1467

Background

The protein encoded by this gene is a type III glycoprotein that is located primarily in limiting membranes of lysosomes and endosomes. Earlier studies in mice and rat suggested that this protein may participate in membrane transportation and the reorganization of endosomal/lysosomal compartment. The protein deficiency in mice was reported to impair cell membrane transport processes and cause pelvic junction obstruction, deafness, and peripheral neuropathy. Further studies in human showed that this protein is a ubiquitously expressed protein and that it is involved in the pathogenesis of HFMD (hand, foot, and mouth disease) caused by enterovirus-71 and possibly by coxsackievirus A16. Mutations in this gene caused an autosomal recessive progressive myoclonic epilepsy-4 (EPM4), also known as action myoclonus-renal failure syndrome (AMRF). Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SR-B2/SR-B2/LIMPII (Q14108).
Sequence	MGRCCFYTAGTLSLLLLVTSVTLLVARVFQKAVDQSIEKKIVLRNGTEAFDSWEKPPLPVYTQFYFFNVTNPEEILRGETPRVEEVGPYTYRELRNKANI
Gene ID
Swiss Prot
Synonyms	AMRF; EPM4; LGP85; CD36L2; HLGP85; LIMP-2; LIMPII; SR-BII
Calculated MW	54kDa
Observed MW	75kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HeLa, MCF7, Mouse brain, Mouse heart, Rat lung
Cellular location	Lysosome membrane, Multi-pass membrane protein