Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | SR-BI Rabbit mAb |
---|---|
Catalog No. | A0827 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0334 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SR-BI (Q8WTV0). |
---|---|
Sequence | MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLKNVRIDPSSLSFNMWKEIPIPFYLSVYFFDVMNPSEILKGEKPQVRERGPYVYREFRHK |
Gene ID | |
Swiss Prot | |
Synonyms | CLA1; SRB1; CLA-1; SR-BI; CD36L1; HDLCQ6; HDLQTL6 |
Calculated MW | 61kDa |
Observed MW | 80kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | 293T, HepG2, Mouse liver, Mouse ovary, Rat liver, Rat ovary |
Cellular location | Cell membrane, Membrane, Multi-pass membrane protein, caveola. |
Customer validation | WB(Mus musculus, Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A0827? Please let us know so that we can cite the reference in this datasheet.