제품 > 항체 > 다중클론항체(pAb)

SREBF2 Rabbit pAb (A25685)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of lysates from HeLa cells using SREBF2 Rabbit pAb (A25685) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020)
Exposure time: 60 s.

ABclonal:Immunofluorescence - SREBF2 Rabbit pAb (A25685)

Immunofluorescence analysis of THP-1 cells using SREBF2 Rabbit pAb (A25685) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of Human testis tissue using SREBF2 Rabbit pAb (A25685) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining.

Immunofluorescence analysis of Mouse testis tissue using SREBF2 Rabbit pAb (A25685) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining.

Immunofluorescence analysis of Mouse brain tissue using SREBF2 Rabbit pAb (A25685) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining.

Overview

Product name	SREBF2 Rabbit pAb
Catalog No.	A25685
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a member of the a ubiquitously expressed transcription factor that controls cholesterol homeostasis by regulating transcription of sterol-regulated genes. The encoded protein contains a basic helix-loop-helix-leucine zipper (bHLH-Zip) domain and binds the sterol regulatory element 1 motif. Alternate splicing results in multiple transcript variants.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 401-500 of human SREBF2 (NP_004590.2).
Sequence	NKLLKGIDLGSLVDNEVDLKIEDFNQNVLLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDRSRILLCVLTFLCLSFNPLTSL
Gene ID
Swiss Prot
Synonyms	SREBP2; bHLHd2; SREBP-2
Calculated MW	124kDa
Observed MW	58kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa
Cellular location	COPII-coated vesicle membrane, Cytoplasmic vesicle, Endoplasmic reticulum membrane, Golgi apparatus membrane, Multi-pass membrane protein, Multi-pass membrane protein, Nucleus.