Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | SREBP2 Rabbit pAb |
---|---|
Catalog No. | A13049 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 155-310 of human SREBF2 (NP_004590.2). |
---|---|
Sequence | MDDSGELGGLETMETLTELGDELTLGDIDEMLQFVSNQVGEFPDLFSEQLCSSFPGSGGSGSSSGSSGSSSSSSNGRGSSSGAVDPSVQRSFTQVTLPSFSPSAASPQAPTLQVKVSPTSVPTTPRATPILQPRPQPQPQPQTQLQQQTVMITPTFSTTPQTRIIQQPLIYQNAATSFQVLQPQVQSLVTSSQVQPVTIQQQVQTVQAQRVLTQTANGTL |
Gene ID | |
Swiss Prot | |
Synonyms | SREBP2; bHLHd2; SREBP-2 |
Calculated MW | 124kDa |
Observed MW | 58kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | HeLa, Rat brain |
Cellular location | COPII-coated vesicle membrane, Cytoplasmic vesicle, Endoplasmic reticulum membrane, Golgi apparatus membrane, Multi-pass membrane protein, Multi-pass membrane protein, Nucleus. |
Customer validation | WB(Mus musculus, Oreochromis niloticus, Danio rerio, Homo sapiens, Mus musculus) IF(Homo sapiens, Mus musculus) RT-PCR(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A13049? Please let us know so that we can cite the reference in this datasheet.