제품 > 항체 > 다중클론항체(pAb)

SRGAP2 Rabbit pAb (A19512)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using SRGAP2 Rabbit pAb (A19512) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Overview

Product name	SRGAP2 Rabbit pAb
Catalog No.	A19512
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This locus encodes a member of the SLIT-ROBO Rho GTPase activating protein family. The encoded protein stimulates GTPase activity of Rac1, and plays a role in cortical neuron development. This locus has several paralogs on human chromosome 1 resulting from segmental duplication. While this locus itself is conserved among various species, the paralogs are found only in the genus Homo, and not in the genomes of non-human great apes. Alternatively spliced transcript variants have been described for this locus.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 790-900 of human SRGAP2 (NP_056141.2).
Sequence	GVVERSSPKSEIEVISEPPEEKVTARAGASCPSGGHVADIYLANINKQRKRPESGSIRKTFRSDSHGLSSSLTDSSSPGVGASCRPSSQPIMSQSLPKEGPDKCSISGHGS
Gene ID
Swiss Prot
Synonyms	FNBP2; SRGAP3; SRGAP2A; ARHGAP34; SRGAP2
Calculated MW	121kDa
Observed MW	140kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse brain
Cellular location	Cell junction, Cell membrane, Cell projection, Cytoplasm, Cytoplasmic vesicle, Nucleus, dendritic spine, lamellipodium, phagosome, postsynaptic cell membrane, postsynaptic density, synapse